A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10084
Swiss-prot Accession number	Q9XT35 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	12890
References	1   Malaivijitnond S., Takenaka O.; "Nucleotide sequences of parathyroid gene in five species of macaqueof Thailand."; J. Sci. Res. Chulalongkorn Univ. 23:135-142(1998).
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10122
Swiss-prot Accession number	Q6EV78 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15183
References	1  PubMed abstract 10612425
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPLCRPINATLAAEKEACPVCITVNTSICAGYCPTMMRVLQAALLPLPQVVCTYHEVRFDSIQLPGCLPGVDPVVSFPVALSCRCGPCHRSTSDCGGPKDHPLTCDHPQLPGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10279
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-18
Mature Hormone Sequence	LDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	18 Residues from position (86-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10329
Swiss-prot Accession number	Q6EV79 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14644
References	1  PubMed abstract 10612425 2  PubMed abstract 10612425
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKEVVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	P32212    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 5

HMRbase accession number	10349
Swiss-prot Accession number	Q9BEH3 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha)(Choriogonadotropin alpha chain) (Chorionic gonadotrophin alphasubunit) (CG-alpha).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13825
References	1  PubMed abstract 11793416 2  PubMed abstract 10612425 3  PubMed abstract 11793416 4  PubMed abstract 10612425
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTMQDCPECKPRENKFFSKPGAPIYQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSLTRVMVMGNVRVENHTQCHCSTCYYHKF
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	P32212    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10855
Swiss-prot Accession number	P30406 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11991
References	1  PubMed abstract 6184262
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10856
Swiss-prot Accession number	P30406 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11991
References	1  PubMed abstract 6184262
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11142
Swiss-prot Accession number	P61279 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12736
References	1  PubMed abstract 2894033
Domain Name	Somatostatin
Hormone Name	Somatostatin-28
Mature Hormone Sequence	SANSNPAMAPRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (89-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11143
Swiss-prot Accession number	P61279 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12736
References	1  PubMed abstract 2894033
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (103-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11170
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11171
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-58
Mature Hormone Sequence	AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	58 Residues from position (46-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11172
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-58 desnonopeptide
Mature Hormone Sequence	AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISD
Position of mature hormone in Pre-Hormone protein	49 Residues from position (46-94)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11174
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-39
Mature Hormone Sequence	YIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (65-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	11175
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-33
Mature Hormone Sequence	KAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	33 Residues from position (71-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11176
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-25
Mature Hormone Sequence	IIKNLQNLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	25 Residues from position (79-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	11177
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-12
Mature Hormone Sequence	ISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (92-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	11178
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-8
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (96-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11179
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-7
Mature Hormone Sequence	YMGWMDF
Position of mature hormone in Pre-Hormone protein	7 Residues from position (97-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11180
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin-5
Mature Hormone Sequence	GWMDF
Position of mature hormone in Pre-Hormone protein	5 Residues from position (99-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11576
Swiss-prot Accession number	Q6DLS0 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney (By similarity).
Protein Length	406 Amino acids
Molecular weight	45011
References	----
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated